SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PKY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PKY9
Domain Number 1 Region: 396-518
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-18
Family Mannose 6-phosphate receptor domain 0.008
Further Details:      
 
Domain Number 2 Region: 214-268
Classification Level Classification E-value
Superfamily EF-hand 0.0000902
Family Calmodulin-like 0.057
Further Details:      
 
Weak hits

Sequence:  G3PKY9
Domain Number - Region: 40-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000275
Family LDL receptor-like module 0.0051
Further Details:      
 
Domain Number - Region: 72-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00182
Family LDL receptor-like module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PKY9
Sequence length 534
Comment (tr|G3PKY9|G3PKY9_GASAC) Protein kinase C substrate 80K-H {ECO:0000313|Ensembl:ENSGACP00000018269} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MTCQHLLLFLLLAVGVSAVEVQRPRGVPLSKRQFYEEGKPFTCLDGSRTIPFDRVNDDYC
DCQDGSDEPGTAACPNGSFHCTNAGFKPGFIPSSRINDGICDCCDTTDEYNSGATCQNTC
RELGRKERESMQKMAEVAKEGFLLKQQLIQESKRGLEEKKAKHADIDLGKKELENKVEAL
RTVKEAAEEPEKEAKERHLKAWEEQKAVIQMEKDKAKMAEVFLELDDDADGFVSVAELLS
HSELDSDLGDSFTEAEAQALLGGADQVDHAAFESVWSNIKGKYVSEHQANADPPAPVETP
LEEIRETDSDHESEQYPEEDIPDEEEEEDDEEEEEDDDTDDREVPPTAQSQEKKDGDDEG
TMPPYDPDTQSLIDAAQKARDAFDEAEKALREVDDQIKNLEKEISFDFGPSAEFAYLYSQ
CYELTTSEYIYRLCPFNRVSQKPKFGGSETNLGSWGQWAGPEDNIYSVMKYDHGTGCWQG
PNRSTTIKLTCGKETVLTSTSEPSRCEYLMEFITPAVCQEPRSLDSDHHEHVEL
Download sequence
Identical sequences G3PKY9
69293.ENSGACP00000018269 ENSGACP00000018269 ENSGACP00000018269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]