SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PL22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3PL22
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00399
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PL22
Sequence length 380
Comment (tr|G3PL22|G3PL22_GASAC) Zgc:66449 {ECO:0000313|Ensembl:ENSGACP00000018302} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MRQCVRGVCSVEHCTNSTRCLLSEDQRRCKCANGYYSDQCDKNAHIKVVCGKDFIAIRAM
EDYFTFHSVPLQSLHLPNKSCRPQREVIDGVPYFVSKISKDEYQMCGGKALTRKNQISYS
LSLQSEPQVIGNIVRNPVIKMNYTCVYPSIRTVSLPFPVIHFSSELVMHLDELDANIQMM
LYTDQSYSKAYSSAPTIGLRDKVYVEVKVTEPADYFLLRLNECWATQFPQPNATAGLVYT
LLLNGCVDDETVSFLKSAGESGGNGESSTIHYSFDMFRFTAEPHDLYLHCTVELCTPEEH
NSCTPNCNSMSKREAMRSDPSLGLLSYGPIRIEMPDRHQSSILATVVLPVAGVWILGFFI
IILITVIKAGNRRFKLTGEQ
Download sequence
Identical sequences G3PL22
ENSGACP00000018302 ENSGACP00000018302 69293.ENSGACP00000018302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]