SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PLI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PLI1
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.05e-55
Family Ankyrin repeat 0.0000798
Further Details:      
 
Domain Number 2 Region: 269-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000249
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PLI1
Sequence length 318
Comment (tr|G3PLI1|G3PLI1_GASAC) Ankyrin repeat and SOCS box containing 7 {ECO:0000313|Ensembl:ENSGACP00000018462} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MLNHHCRRNPELHEELQIQAAVAAGDVCTVRRMLEQGYSPKIRDANGWTLLHFSAAKGKE
RCVRVFLEHGADPTVKDFIGGFTALHYAAMHGRARIARLMLELEFRSDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFRAEVDPLSDKGTTPLQLAIIRERSSCVRILLDHSANIDIQN
GFLLRYAVIKGNHTYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCAQMLYTYGGDA
NTRNYEGQTPVAVSVSMSGISRPCLDFLQEATRQPRTLQDLCRIKIRHCIGLHSLKLLED
LPIAKVMKDYLKHKFDSV
Download sequence
Identical sequences G3PLI1
ENSGACP00000018462 ENSGACP00000018462 69293.ENSGACP00000018462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]