SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PLK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PLK6
Domain Number 1 Region: 583-873
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.29e-82
Family Protein kinases, catalytic subunit 0.000000000615
Further Details:      
 
Domain Number 2 Region: 18-192
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-76
Family Ephrin receptor ligand binding domain 0.000000111
Further Details:      
 
Domain Number 3 Region: 320-525
Classification Level Classification E-value
Superfamily Fibronectin type III 2.44e-39
Family Fibronectin type III 0.00000672
Further Details:      
 
Domain Number 4 Region: 865-936
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.88e-22
Family SAM (sterile alpha motif) domain 0.00026
Further Details:      
 
Domain Number 5 Region: 250-320,358-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000141
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PLK6
Sequence length 941
Comment (tr|G3PLK6|G3PLK6_GASAC) Receptor protein-tyrosine kinase {ECO:0000256|SAAS:SAAS00593197} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
PRLTAVFVYLLFSPFSAETVMDTRVATAELGWTAYPNSGWEEVSGYDENLNTIRTYQVCN
VFEPSQNNWLLTTFIDRRGAQRIYVEIRFTVRDCSSIPNVPGSCKETFNLYYYETDAVIA
TKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGA
CMSLLSVRVFYKKCPSVVQNFAIFPETMTGAESTSLVIARGVCIPNSEEVDVPIKLYCNG
DGEWMVPIGSCTCKAGFEPDNGNVCRACPPGTFKSTQGPGLCLQCPPNSRSTAEAATICV
CRNGYYRGDGDQPDEPCTSVPSSPRNVISIVNETSVILEWHSPRETGGREDVVYNIVCKK
CRADRRSCSHCDDNVDFVPRQLGLTDTRVFISNLWAHTLYSFEIQAVNGVSNRSPYPSQH
VSIDITTNQAAPSIVPIMHQISSTMNSFTLSWPQPEQPNGIILDYELRYYEKDHAEINST
ILRSQTNTARVEGLRPGTVYVVQVRARTVAGFGKYSSKMCFQTLTDDDFKSELREQLPLI
AGSAAAGVVFIVSLVAISIVCSRKRAYTKEAVYSDKLQHYSTGRGEFGEVYKGRLKLPGK
REIYVAIKTLKAGYAEKQRRDFLAEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENG
ALDSFLRQNDGQFTVIQLVGMMRGISAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDF
GLSRYLQDDTSDPSYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGER
PYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNVRPRFSDIVSTLDKMIR
NPTSLKAVANIPAVPSQPLLDRSIPDFNSFSSVEDWLAAIKMSQYRDNFLNSGFTSLQLV
AQMTSEDLLRIGVTLAGHQKKILSNIQTMRVQMSQSPTTMA
Download sequence
Identical sequences G3PLK6
ENSGACP00000018487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]