SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PMI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PMI9
Domain Number 1 Region: 1787-2014
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-36
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 2 Region: 2039-2231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-32
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 3 Region: 1287-1424
Classification Level Classification E-value
Superfamily Cadherin-like 8.77e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 420-549
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-27
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 1072-1182
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-25
Family Cadherin 0.00024
Further Details:      
 
Domain Number 6 Region: 966-1079
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 864-972
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.00096
Further Details:      
 
Domain Number 8 Region: 211-320
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-24
Family Cadherin 0.0017
Further Details:      
 
Domain Number 9 Region: 742-838
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-23
Family Cadherin 0.00073
Further Details:      
 
Domain Number 10 Region: 314-434
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 530-649
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-20
Family Cadherin 0.0042
Further Details:      
 
Domain Number 12 Region: 1184-1291
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 13 Region: 10-107
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0034
Further Details:      
 
Domain Number 14 Region: 119-229
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000034
Family Cadherin 0.0056
Further Details:      
 
Domain Number 15 Region: 638-754
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000243
Family Cadherin 0.0026
Further Details:      
 
Domain Number 16 Region: 1398-1512
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000257
Family Cadherin 0.0021
Further Details:      
 
Domain Number 17 Region: 1508-1608
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000537
Family Cadherin 0.03
Further Details:      
 
Domain Number 18 Region: 2273-2312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000135
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PMI9
Sequence length 2529
Comment (tr|G3PMI9|G3PMI9_GASAC) Si:ch211-186j3.6 {ECO:0000313|Ensembl:ENSGACP00000018820} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
EWYLVRVELTVTDVNDNIPEWVMVPAPYLAVVSPDATAGALVYKLHAEDGDEGNNGEVEY
FLSDGGDGRFEVDRKSGHVQTTGLPLQRDREYLLTVVAADRLGSRSAPVVVSVVAGARPP
QFTNASFTIGIPENTPEGQPFLVTPAVSFQKKLISYSLLINPSSLFSISAETGEISLTRP
IDYESDQHRYLLLVRASEGLDSMSSAAEVRVVIVDENDCVPEFLQSIYSKDGVPETVTTA
TSLLQVSANDCDSEENAELTYYTLSPDFTISPHGTIFPAGPLDYERPNHLYEFVVMAVDK
GEVPRTGTTTVRIRMANVNDEAPEFSQHIYRTFVSEDAGPNTLVATVLAKDPDGDGITYV
ITTGNEEGNFVIDSQKGLIRLRSSPPPHLQGVEYVLNVTAEDDNASGGPQALSSTAQVIV
GVDDVNNNKPVFEKCQQYRESTSVLENQPAGTFVLQVHAVDADEGSNGRVTYGFMHKDST
VPAFSIHPDTGRVIVTARRYDRERQREYAVTVTATDQAVDPLIGICQLNVLILDQNDNSP
KFENIRYEYFLREDTMIGTSFLRVAAHDDDFGTNAAVTYSMSREQPEYLRVNPLTGWVFV
NQPISQRTYITRDIVATDGGNMSSSVELSVTITNVKNQPPQWDKDSYSVVIPENTVRDTA
IVNIKATSPLGDPRVTYNLEDGMVPETNMPVRFYLTPNREDGSASILVAEPLDYETTRNF
MLRVRVQNVAAVPLAAFTTVYINVTDVNDNVPFFTSSIYEASVTEGAESGTLVFQVSAND
LDLGLNGKVISYSLLEDRSGDHQYFRIDPELGLIYSQTVFDRETKSSYLLEVQSVDGWES
ARPGKHGQPNSDTAYVRVFISDVNDNKPAFAQVSYEVDVDEDADVGFAVLTVSANDGDEG
GNAKLRYQITSGNTGGVFDVEPEVGTIFIAQPLDYEQNKRYKLLVLASDGKWEDYTTVAV
NVMNKNDEAPVFTVNEYYGSVTEELDGSPVFVLQVTASDPDKDADQEALRYSLHGQGAES
EFIIDEVTGKIYAQRTLDREERAVWRFVVLATDEGGEGLTGFTDVIINVWDINDNAPVFT
CAPSCHGDVAENSAAGTSVMEMTATDLDDAAVGQNAVLSYRIMGSLDTTSIQEMFTINPT
TGTITVAMGGLDREQVESYLLVVEARDGGGMTGTGTATVQIKDVNDHAPRFTERSCLARI
SENAETNAEVLELTAEDSDTGENAQLTFSVVAGDQEQKFYMVSHKQEQRGTLRLKKRLDY
ERHSEQRFNLTLKVEDMDFSSLLHCAVEVEDSNDHAPVFIPHLLALAPLPEDIDVGTSVA
RLVASDSDSGQNRDMTYSLSEDSDPDGLFTIDQSGVLSVARLLDRERISQHHLVVIATDH
GVPPLTGSATVQLPLLDVNDNGPEFEAAYSPVVFENAAGPQVVQLNQTSTLLHAVDRDSP
ENGPPLHFTVPSEYRHSNDFYLQDNLNGTATLTALRTFDRERQKEFLLPIIMSDSGHPAK
TVTTTLTVTIGDQNDHAHVAGEKKIFINSHRGRMPTTVLGKVYSPDPDDWDNKTYVFEGH
IPSYFILNKRTGFLIIKENTPPDVYHFQVRVSDGVWPDAVSSVTVHVRELRDDAIYNSGS
LRLADITAREFIELRGKQRSRYELLLDFLSEMLSVPPDDVNIFSLMDVKERMLDVRFAVR
GGPSFLQPEKIHGYVAAHKQKLQSFLQVNVFQVRVDECPGSECAGAGGCTSALNVRDTPT
VVDCGTMSLVSVTVESTAACLCPGREQSHQPCTSYPRNPCFNGGVCVDTQHGYRCQCPSQ
FEGPECQQNKHSFHGNGYAWFPPVMPCFESHVSLEFITEVADGLLLYNGPLAQLQAWDHE
DFMAIELIDGTPTLKINHGSGTVVLQLPGNVNVADRRWHRLDVRSNSKEVRFTLDRCSGA
AVMEMEGLGSWVTTEDHSSCEVTGVTPNADRHLNMSQVLQLGGVNEDIPYIYPQLQHKHF
TGCIRNLIVDSKLYDLGSPADSQSSSSGCLTTDSSCVNMGYPSCGHRGRCHGEWGSFSCQ
CVPGYAGHHCEEEAPEYTFDGHSHVHYQLASPLSARRTWVQVLVRTRKHSSTILNLSSKE
LSEYIRLEIFQGLLCVFYNLGDGDFNLTLPTYRLDNGDWHEVFLDRHDNEMTLRLDGGGG
QREVKGSRGRSREIIIDPTVVMLGNTFPSGINKSFQGCMRDARLNGRYLPLDSQTRDGVS
QVSIQGLSPGCSSDSCKRNQCSAPFTCVDLWRVHECRCPPGHMIRVNGTRKSCVYTLCAT
RPCHRGTCVAQSPSKFTCHCPEGYRGRHCETPLAIYREDVGLSFSSLFAICICFMALLVL
LLGIFSYTRWRSYKGLKEGVYHVSAHHDGWEDIRENVLNYDEEGGGEEDQNAYDMAELQK
SLQPSPAQSVQYCRSRALHHPPPPLHHHHLLHQAPPAPSAARTLARYLCEIIRDADQHRD
TGPFDSLQVFSTEGGGSPAGSLSSFSSAGLDGNRGGEGVEEGRREETLGEWGPRFEKLRA
LYERAEASD
Download sequence
Identical sequences G3PMI9
69293.ENSGACP00000018820 ENSGACP00000018820 ENSGACP00000018820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]