SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PMW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PMW2
Domain Number 1 Region: 59-151
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-22
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 2 Region: 154-202
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000471
Family SOCS box-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PMW2
Sequence length 203
Comment (tr|G3PMW2|G3PMW2_GASAC) Suppressor of cytokine signaling 1a {ECO:0000313|Ensembl:ENSGACP00000018945} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MVADSTVEGHDKTTHPKESEHLQRQAAADPGPGPRSASVPSAHLTHFPTFSCKEDCKIIT
ETASKLERSAFYWGPLGVEEAHRMLRDAPLGSFLIRDSRQKDVFFTLSYHGKSGPVSVRI
DYKLQKFSLAGNERCFPTLFALLEHYANSPKRSLRFPYRKWKPTLQELCRKRIMELCGGG
GQVATLPLTHVVQDFLLEFPFKL
Download sequence
Identical sequences G3PMW2
ENSGACP00000018945 ENSGACP00000018945 69293.ENSGACP00000018945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]