SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PP63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PP63
Domain Number 1 Region: 52-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000235
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PP63
Sequence length 237
Comment (tr|G3PP63|G3PP63_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000019396} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
WTCVQRRPASSSALITLGEWCTCYPGYRFDRDRHRNHKSPYCLGHDECEHPGNGVCDHEC
VNTVGSFLCRCHSGYILAPDQRSCIPVHNLSSSGKSDTLMSAGTCSFTCEDFINMKNSLL
QLKLRLANTQSPNQVPDLANSSDKPSLGRAGLPGPPGAPGVPGNDSSPGHPGEPGKRGGP
GDRGPPGSRGDMGPMGPEPDLKHVKRGRRGPVGPTGATGRDGLKGDRGAPGPIGPPV
Download sequence
Identical sequences G3PP63
69293.ENSGACP00000019396 ENSGACP00000019396 ENSGACP00000019396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]