SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PPH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PPH9
Domain Number 1 Region: 67-106
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000144
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PPH9
Sequence length 146
Comment (tr|G3PPH9|G3PPH9_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000019513} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MEHYRGTFSLWCHPKLEDRCLSVVEFIERAIMYSKNGKFLYFLRSRVPGLPPTPVQLLYP
VSRFSSVKTLQHLCRFCIRQLVRIDHIQELPMPMPLIAYLGKFYYYDSEEEVSPSLKERG
LETQGCLVQQVQPVVQPVHHGLHSNT
Download sequence
Identical sequences G3PPH9
69293.ENSGACP00000019513 ENSGACP00000019513 ENSGACP00000019513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]