SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PRF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PRF2
Domain Number 1 Region: 74-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.2e-58
Family Astacin 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PRF2
Sequence length 266
Comment (tr|G3PRF2|G3PRF2_GASAC) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VKMTPTASLLLLLLLGFSEAYPLVDEGTEANDQMDEDDSIDISTRILNSNNGSNEMLLEG
DVLVPTTRNAMKCFYQQCLWKKASNGLVTIPYIISNEFTGAETQVIDRGLKSFHTGTCIR
FVPRSNENDHISIESRGGCFSSMGRTGGRQVVSLNRQGCVYYGIVQHEVNHALGFNHEQT
RSDRDSYVRINWENIDPQNAYNFQKEDTNNLNTPYDYSSVMHYGNTAFSINGRDSITPIP
NANAQIGQRNGMSYWDIKRINLLYGC
Download sequence
Identical sequences G3PRF2
ENSGACP00000020187 69293.ENSGACP00000020187 ENSGACP00000020187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]