SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PRY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PRY6
Domain Number 1 Region: 280-405
Classification Level Classification E-value
Superfamily ApaG-like 2.09e-38
Family ApaG-like 0.00029
Further Details:      
 
Domain Number 2 Region: 99-267
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.32e-19
Family SMI1/KNR4-like 0.0092
Further Details:      
 
Domain Number 3 Region: 9-83
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000196
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PRY6
Sequence length 407
Comment (tr|G3PRY6|G3PRY6_GASAC) F-box protein 3 {ECO:0000313|Ensembl:ENSGACP00000020372} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VLLTMSASAELRMDQLASDPLLHILSFLGFRDLIHCSFVSRRLYDLSKHNPLWRSLCCKH
WLLTEADRLQSGASWHCLFRRYYVDLGRYLQYYPVLKRAWEQLKVFLQQRCPRMIASLKE
GATEVELNDIEVQIGCRLPDDYRCSYRIHNGQKLVIPGLMGSMSLSNHYRSEVLLDVETA
AGGFQQRKGMRRCLPLTFCFHTGLSQYMALEPAEGRRVYESFYPCPDQTAQDPSAIDMFI
TGSSFLQWFTAYVHNVVTGEYPIIRDQIFRYVHEDGCVETTGDITVSVSTSFLPELSSVH
PPHFFFTYRIRIEMSGAASPEASCQLDSRYWKITTSDGNVEEVQGPGVVGEFPVMTPGKV
HEYASCTTFSTPTEYMEGHYTFHRLANKEEVFHVAIPRFHMICPPFR
Download sequence
Identical sequences G3PRY6
ENSGACP00000020372 69293.ENSGACP00000020372 ENSGACP00000020372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]