SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PSC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PSC2
Domain Number 1 Region: 256-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000324
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 101-149
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 177-242
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000824
Family Pre-dockerin domain 0.026
Further Details:      
 
Weak hits

Sequence:  G3PSC2
Domain Number - Region: 436-495
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00536
Family Carboxypeptidase regulatory domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PSC2
Sequence length 1101
Comment (tr|G3PSC2|G3PSC2_GASAC) Cartilage intermediate layer protein, nucleotide pyrophosphohydrolase {ECO:0000313|Ensembl:ENSGACP00000020508} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
EWTTWFNVDHPGGRGDYEQLEAIRFYYRARVCETPRAIEARTTDWVPARKTGETVHADPT
VGFWCLNEEQGPERNCSNYAVRFLCPKGSISENNSENLLDNWGPWSDWNACSALCGQSGV
QVRSRNCQSRSAPCSGPKAEEVACSGPKCPKTDCSLQCVMGKVNAECDACMCEEHILLGS
VRGAGGLTAEGATILRSGKLLTLTDHNGHFRIPGICPDGNTTLSVQLQGHSTLSAVVPHS
GERTSVLSVRLKRTEKLHLLGSPESKVRREGHTAAFCCKVSGTPQPDTYQWFHNNSLLEK
QSEGTMVLKNLRLDQTGEYYCKASGPSGAIKTKPATLKVLGRDEHSCNPSPESHLIRLPH
DCHQNSTDSFYYDVGKCPSTICAGQLDNGIRCKDKMAYCCGVKKMEKRQLTCQGYQLPTM
VVTECGCQKCVDTRAIVHGRAVAADNGEPMRFGHVLMNGVRISRTGYKGTFSIQVPPDTL
RLVLTFVDNMQKFVNTTKVLPFNTKGGAVYHEIKLLRKKRPVTISPTEVNTLELGEVEGQ
EAMIQIQIPPYAFYTEKGEVFTGNVNASVTFLDPRDVSTAAAAQSDLNFVGDEGDTLPLR
TYGMFSVDFRGEENNEPLNAGEVKVFLDSAQVKMSEHLDTMKLWSLNPDTGLWEEEGSLQ
VEKKRRGKREERTFLIGNMEIRERRLFNLDVPENRRCYVKVRTFRSERFMPSEQVEGVVV
SLINMEPTAGYSSNPRAWGRFDSVVTGSNGACLPAFCDEQKADAYSAYVMANLGGEELEA
VASAPKLNPNLIGVPQPRLGKLNYRRTDHEDPKVKATAFSINVAKPSSNTAEEGSGPVYT
FENLKECEEASFSAAHFRFSRVEGDRYDYNTVPFNEDNPMSWTEDYLTWWPKPMEYRACY
VKVKINSPHEINVRSRNMGGTHPKTVGQLYGLRDTRSIRDMDRPTVSAVCEFKCSGMLYD
QERVDRTLVKVIPQGSCKREQVNTILQEYLVNHLPLAVNNDTNEFTMLAPLDPLGHNYGI
YTVTDQDPRTAKEIALGRCFDGSSDGTSRVMKSNEGVALTFTCGDREVKSQSPFQASSQR
QTVTSAARGEGRQNRRRQRAN
Download sequence
Identical sequences G3PSC2
ENSGACP00000020508 69293.ENSGACP00000020508 ENSGACP00000020508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]