SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PSD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PSD4
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily DNase I-like 2.36e-17
Family Sphingomyelin phosphodiesterase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PSD4
Sequence length 179
Comment (tr|G3PSD4|G3PSD4_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000020520} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MLKKSRITLLDSETVAYPTSGMMRSLLVAQVLFRGRKFCLMTSHFESCKANAAERMKQLR
LVMKRMAKVPDDVTVLFGGDTNLRDAEVAKVGLPGCVCDVWEQLGEPEDCRYTWDTHANT
NNDHRYKSRFRFDRLYLGRAGGDAALEPESMALVGLEKLKCGRYTSDHWGIYCTFSAVL
Download sequence
Identical sequences G3PSD4
ENSGACP00000020520 69293.ENSGACP00000020520 ENSGACP00000020520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]