SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PTA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PTA4
Domain Number 1 Region: 36-102
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Ovomucoid domain III-like 0.0054
Further Details:      
 
Domain Number 2 Region: 131-195
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000166
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 3 Region: 234-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000185
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PTA4
Sequence length 342
Comment (tr|G3PTA4|G3PTA4_GASAC) MSANTD3-TMEFF1 readthrough {ECO:0000313|Ensembl:ENSGACP00000020840} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=MSANTD3-TMEFF1 OC=Gasterosteus.
Sequence
GGGAGFGGGCAPELLRSVSSFSVADLSEKKSDLRVCDESTCRFSGACRDDGAQLKCVCQF
QCHKNYVPVCGSNGDTYQNECYRRQASCKQQRAILRVSDGPCSADPGSGSGDGYDDEGSG
SDVGKKFTKCSTCKYGAECDEDSEDVWCICNIDCSGHNENPVCATDGNSYNNPCLVREAS
CMKQEQIDVKHLGPCPVTADKDKPGKKDDSSPFKVNVLETTGLDHGDGFYAGRPIPCSES
YAGYCVHGKCEMKYSTASCRCDAGYRGAQCDEPQDFNILYVVPSGQKLHYVLIAAIIGAV
QIAIIVAVVMCITRKCPKNQRGGRRQKQNLGHFSSDPGSRMV
Download sequence
Identical sequences G3PTA4
ENSGACP00000020840 69293.ENSGACP00000020840 ENSGACP00000020840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]