SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PTP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PTP6
Domain Number 1 Region: 136-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 2 Region: 56-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000895
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PTP6
Sequence length 271
Comment (tr|G3PTP6|G3PTP6_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000020982} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MYRALLLSSLVLHVMGTPQFLGRHGRRVCGRDLRHSVATATESYVRPVHKPYITLCQGHR
LCSTYKTVYSVAYRQVSRAAPTSHLPSECCPGWRRFHSHNCNQAVCGQPCVNGGTCLRPN
QCTCPLGWKGHQCQTDVDECGEQRPCAQMCLNTAGSYRCACRDGFGLAGDGRSCQTKRTN
AERNLSEGFGQVENVTEEVQSLRNRVELLEKKLQLVLAPVSSFFPLSLDEGWSEKTTLLS
HSFQQLDRIDSLSEQIGFLEERIGTCSCQEN
Download sequence
Identical sequences G3PTP6
ENSGACP00000020982 69293.ENSGACP00000020982 ENSGACP00000020982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]