SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PTU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PTU1
Domain Number 1 Region: 80-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000011
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 239-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 197-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000141
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PTU1
Sequence length 437
Comment (tr|G3PTU1|G3PTU1_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000021028} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
SFENMIAAIFIPLMCFCSLHPTFGQDCPSRQEIQGSLKQVQKLLSTHEASYSQSLRNLKK
KINLLLSSAGKQTTRSINTTCPRLDAPINGRKLGKSHAVGHEVHLLCDPGYELVGSESRV
CQEGSTWSGQLSACRDINECASSPCLNGGTCVDEVNQFSCICTKGWAGVTCQSPVPTSTA
AASILPAATMGPFVRPSRCTVVQGTTHCTCEPGYTISGRDSNTCSDIDECELFHNSQAGR
LCLHACVNTPGGYRCSCPIGYNVTRDGRSCKDIDECATRQNNCTKDQMCINTYGAFQCVR
VDCPKIPNATYVKTSPMRCERNPCPVDNKACSQTPNSFSYHYLAVVSNLSAPRVMFRVSA
LRPIGDTLRFSLLGGKQARRHFTVQRSDRVTGQLMLVNPVHGPATLEAEVEMSELERRVQ
LGRYITKITMFVSQYEF
Download sequence
Identical sequences G3PTU1
ENSGACP00000021028 69293.ENSGACP00000021028 ENSGACP00000021028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]