SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PUH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PUH4
Domain Number 1 Region: 58-565
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.54e-186
Family Myeloperoxidase-like 0.000000000000473
Further Details:      
 
Domain Number 2 Region: 18-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000306
Family EGF-type module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PUH4
Sequence length 586
Comment (tr|G3PUH4|G3PUH4_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000021261} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
FNRERLRRPDCGLGQCMNPCCYLPCQHWGACVRYGEDKYECDCTRTGYSGENCTVPEFWT
RVRLLVKPSPDVQHYVLTHFNRLWDVINSSFLQNVLMRLVLTVRSNLIPSPPTYNSKYGY
LSWESYYNLSYYTRILPPVPKDCPTPLGVKGEAGLPDPELLVDRLLKRRTFRPDPQGSNL
LFAFFAQHFTHQFFKTYNRMGVGFTKALAHGVDAGHVYGDNLQRQLRLRLHKDGKLKYQL
VKGEMYPPSVADAPVRMSYPPGVPPKAQMAIGQEVFGLLPGLGMFATLWLREHNRVCDIL
KAEHPTWDDEQLFQTTRLVIIGETIKIVIEEYVQHLSGYLLQLKFDPTLLFNSGFQYGNR
IALEFSQLYHWHPLMPDSFLINGDELSYKQFLFNNSVLTDYGIEKLVDAFSRQVAGQVGG
GYNIHAAVTNVAVVTIKESRQLRMQPFNEYRKRFNLQPYTSFSQFTDNEEIARELEELYG
DIDAMEFYPGMMLEKTRQGAIFGESMVEMGAPFSLKGLLGNPICSPSYWKPSTFGGQVGF
DIVNSATLKKLVCQNTRTCPYVAFRIPTEEQSKRGNGDSKTRTDEL
Download sequence
Identical sequences G3PUH4
ENSGACP00000021261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]