SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PUJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PUJ9
Domain Number 1 Region: 319-444
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000416
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 2 Region: 488-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 452-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 4 Region: 294-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  G3PUJ9
Domain Number - Region: 260-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PUJ9
Sequence length 739
Comment (tr|G3PUJ9|G3PUJ9_GASAC) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MGRLFLLLVVTLSLLTCQVMCSGVFELKLQEFLNKKGGPGNSNCCPGGSAHQQGHSQQCE
CKTFFRVCLKHYQANVSPEPPCTYGGAVTPVLGSNSFQVPETNADSFTNPIHFPFGFTWP
GTFSLIIEALHTDSLDDLTTDNPERLISRVTIQRHLTVGEEWYKDIQTAGRTELRYSYRF
LCDEHYYGDGCSVFCRPRDDAFGHFTCGERGDIICNSGWKGQYCTESICLPGCDEEHGFC
DKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKP
CLNGATCTNTGQGSYTCSCLPGYTGASCEIQVSECSGNPCRNGGSCSDNDSGYKCTCPPG
FYGNNCELSANTCADGPCFNAGRCTDNPEGGYFCQCPMGYAGFNCEKKIDHCSSNPCSNG
AKCVDLVNSYQCQCPEGFSGQNCEGSSSLSGYCQSFPCQNGGTCQEEANGYTCTCPPAYT
DENCSSPISRCHHDPCHNGATCHERGGRYVCACVPGYGGHNCQFLLPEVPRDEEDDDSGF
PWTAVCAGVFLVLVILIGSSVLVVYIRVKLQERNSHHGDSVHSDSRETMNNLTTTNNCLR
SDKEQGAVMTTSIKNINKKVDYHSDIDGPLGSLSGMSGLNGSEKNGFKTRYPSVEYNLVH
ELRPEDLSLCKEDERDEPEVKCEMFDEADSEERYRKRQHSEVEYHSSSDSRYQCTNGTKY
QSVYVMSEQKDECIIATEV
Download sequence
Identical sequences G3PUJ9
ENSGACP00000021286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]