SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PVD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PVD3
Domain Number 1 Region: 524-569
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 97-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000147
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 479-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000789
Family EGF-type module 0.034
Further Details:      
 
Domain Number 4 Region: 43-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000876
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PVD3
Sequence length 569
Comment (tr|G3PVD3|G3PVD3_GASAC) Complement component 8, alpha polypeptide {ECO:0000313|Ensembl:ENSGACP00000021570} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
ASLWRLHYPGEKAGSSIYFTTEEENLCMAGSRRARAVNRPAPINCQLQAWSSWTSCDSCT
DQKGRFRRMEKPSQFGGTECVESLWEKLACPSAATECLVTDYCGERFTCKETGRCISQSL
RCNGESDCNDFSDEDGCEVVNRRGDKPTRQYSLINKLLSDFSYNVLTGDFVDRVLDSNYF
GGKCEYVYNDEKNYRKPHNYHTYQFVAEATSEGSQDYFTDAVSLLNARKTMSSANGGVTL
GIYKVEVGLSGSSESEFFNNVTQYNSQELGFVRLFSKVQTAHFKMRSNKLMLDEEFYVSL
MELPEQYHFGTYSRFFNTFGTHYVTEGTMGGTLEYVVVLNKTAMAESNTEAEQAGVCLGA
SIGLSQNLSTNVNVDLKVKGNVCRKERSTHRTNDSDSAEIVDIVSLVKGGVTHSSAGLLA
IRNPDTYRSWGASLRYNPTLIEYETMPIYELVRLSTAADHVGARLANLERGWDEYQRQFD
SCRCAPCRHNGIPVLTGTSCRCVCKPGFQGKACEETLRKDAPTDGSWSCWGAWSSCSSGK
KTRTRTCDNPAPDGGGTTCLGSSSQAQRC
Download sequence
Identical sequences G3PVD3
ENSGACP00000021570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]