SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PVQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PVQ6
Domain Number 1 Region: 19-231
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.11e-51
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 237-281
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000575
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PVQ6
Sequence length 283
Comment (tr|G3PVQ6|G3PVQ6_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000021695} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
VPCKLEVSLLSPFRTDSVRSWADRSPLHEAASQGRLLALRTLLAQGYHANIVTIDHVTPL
HEACLLGHVACVRALLNAGANVNSATIDGVTPLYNCCASGSVGCLELLLQNGAHTHTPHT
HFPSALHEACKRGNSQCVESLLSHGADPDHEVSHLGTPLYMSCLHQHTACSKILLHRGAD
VNVGKGSESPLHATARLDIAEQVLVLLDYGANVNIRDDNDQRPVELAPAGGKTQQLLQTF
EGGPRSLCQLCRLQIRILIGRSRLKLLPLLPLPTLLTDYLAHV
Download sequence
Identical sequences G3PVQ6
69293.ENSGACP00000021695 ENSGACP00000021695 ENSGACP00000021695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]