SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PWA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PWA0
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-26
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 2 Region: 378-538
Classification Level Classification E-value
Superfamily Ras GEF 9.68e-21
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PWA0
Sequence length 669
Comment (tr|G3PWA0|G3PWA0_GASAC) SH2 domain containing 3A {ECO:0000313|Ensembl:ENSGACP00000021889} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=SH2D3A OC=Gasterosteus.
Sequence
MDSFKKELEEELKLSTDDPRSHAWFHGPLSREAAESLFERDGDFLVRESSSSPGDYVLSC
FWKDGPMHFKIIRVILRPKEGYSRELFQFEKDRFDNVPALIRFYVGGRLPISQGSGAVIF
HPITRTLPLRVIAERGVEPPARREKPSQANIRRSFSSEHADALEAVNPLLRWEEGGRSGS
QPANMENVGRGPSLQSAQSDSNLRTGVPQSAPSKDTEPAPISPVFRTGSEPLLSPRPRHT
RPSHPGGGVTLRGSDGQLHPRAPPKPLRVSTIFGNGVPPPPTDPSSFYDELVIQVPQARQ
KGHVDRLRAEEKWQSRARLTETSFGFLEAQKNEEASQLPQKMTPPGGEDWHFQKPQVESA
SCFQLDQFHSKLLPENNRPLEPAVLLALKELFNRSKAEATALHMLSVDCQVARIVGVTDE
QKTSMGVGSGLELVTLPHGSQLRKDLLERHHLIALGVAVDILGCTGTVSQRATVLHKLIL
LAQALKEHAHNLYSFSAVMKALDMPQITRLEMTWRALRRNHTDTAVLFEKKLKPFMNLLN
DGDDSVVSGPVAVPHLVPLLMAMEGDDPVEDSERGCELLYDVLQAARRAALHAPDYQQHA
RALLAGSWEPVPELLEAFRTEFALRLLWGHSGSLADKAERYEKFDKILHVLSDKLEPVVI
TPLQPDLLT
Download sequence
Identical sequences G3PWA0
ENSGACP00000021889 69293.ENSGACP00000021889 ENSGACP00000021889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]