SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PWB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PWB1
Domain Number 1 Region: 44-155
Classification Level Classification E-value
Superfamily FKBP-like 3.07e-36
Family FKBP immunophilin/proline isomerase 0.00000219
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.00000000000638
Family WW domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PWB1
Sequence length 156
Comment (tr|G3PWB1|G3PWB1_GASAC) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363014} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MADEEKLPGGWEKRMSRSSGKVYYFNHITNASQWERPVGDGRGEPEKVRCSHLLVKHSQS
RRPSSWREQNITRTKDEALELIQKYIEDIKSGEEKFESLASQFSDCSSAKNGGDLGLFGK
GQMQKPFEEASFALKVGDMSGPVFTDSGVHIILRTG
Download sequence
Identical sequences G3PWB1
ENSGACP00000021900 ENSGACP00000021900 69293.ENSGACP00000021900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]