SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PWB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3PWB5
Domain Number - Region: 148-186
Classification Level Classification E-value
Superfamily Pili subunits 0.0361
Family Pilin 0.01
Further Details:      
 
Domain Number - Region: 93-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0523
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PWB5
Sequence length 332
Comment (tr|G3PWB5|G3PWB5_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000021904} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MVGVWSSGHAVQSLVGFRTSGALRWLGVTGPASLLERTGLAQAVREGRSFRSSKITNITL
GGVQGDVCDWLLQCPEGYECVFNPGTSNYSCSSRCHFDYCHHRGICTHHPGQLPVCRCLV
GEDFWFMGRRCDVRMTRARLVGACLAVLLIMVTLIGVLALVAVRRYRAILIQAKVDQTRS
SYRRFNHFDELSGRFWLRSWAGSADSLDNPAFTRSDELLHLRALDRPCCYHDDTLSLAST
CPSHGARINTIYPHSSQYGWRGSEVSMADGVLDSGKASDLSVCSWPVEPIHWTPFPLLQQ
LASHRTPAARVSRPRSYCEGMELADLGKSWTA
Download sequence
Identical sequences G3PWB5
ENSGACP00000021904 69293.ENSGACP00000021904 ENSGACP00000021904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]