SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PXA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PXA9
Domain Number 1 Region: 155-302
Classification Level Classification E-value
Superfamily EF-hand 2.8e-49
Family Osteonectin 0.000000263
Further Details:      
 
Domain Number 2 Region: 96-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000998
Family Ovomucoid domain III-like 0.0001
Further Details:      
 
Domain Number 3 Region: 71-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000323
Family Follistatin (FS) module N-terminal domain, FS-N 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PXA9
Sequence length 304
Comment (tr|G3PXA9|G3PXA9_GASAC) Secreted protein, acidic, cysteine-rich (osteonectin) {ECO:0000313|Ensembl:ENSGACP00000022248} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MRVWIVFLLCLAGHAMAVQTEEEPIVEELVTEEPVVEETEVGVNPVQIEIGEFDEAIDAT
EEEEEEVTTENPCLNYNCKKGKVCEVDESNTPMCVCQDPSTCPTAEGEFEHVCGSDNKTF
DTACHFFATKCSLEGTKKGHKLHLDYIGSCKYIEPCMDTELGEFPLRMRDWLKNVLVTLY
ERDEDNNLLNEKQKLRVKKIFENEKRLQAGAHSLDLLAHDFEKNYNMYIFPVHWQFGQLD
QHPVDGYLTHTELSPLRAPLIPMEHCTTRFFEQCDADNDKYIGLEEWAACFGIKEQDVDN
DLIV
Download sequence
Identical sequences G3PXA9
69293.ENSGACP00000022248 ENSGACP00000022248 ENSGACP00000022248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]