SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PYR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PYR6
Domain Number 1 Region: 214-480
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 2.22e-16
Family Soluble quinoprotein glucose dehydrogenase 0.0032
Further Details:      
 
Weak hits

Sequence:  G3PYR6
Domain Number - Region: 640-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000232
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PYR6
Sequence length 703
Comment (tr|G3PYR6|G3PYR6_GASAC) Hedgehog interacting protein {ECO:0000313|Ensembl:ENSGACP00000022756} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
TMKHLQVVLVLSIAVSVWECGDAKFGERGEIGPRRRRCYDGSLPKRLKKRERKVLLDGSN
SGEVCHRLYPRVSCCPTRRAAYQILHRRDARIFSTNNTDCGHLLEEIKCARCSPNAQMLF
HSLDMDKVPHREPDLPRLCLDFCREFYYTCRGHIPELFQADVDEFCQYYGRRDASLCFPD
FQRKQLQGQDSNFLEDEKRDVKKNNNNKKHKHNCYCAQEVLSGLRQPVAVVHCGDGSQRL
FVLEREGIVRILNHDLELIKEPFLDIHKLVQNGLKGGDERGLLSLAFHPNYKKNGKLYVS
YTTNQERWAIGPHDHILRVVEYTVSRKNPNQVDMRSVRVLMEVAELHRKHLGGQLLFSPD
GLLHIVLGDGMITLDDMEEMDGLSDFTGSVLRVDVDTDCCTSPYSIPQDNPYFNSTNQPP
EIFAHGLHDPGRCAVDRLQTDNGSLLMICTDASGKNASAGRILEITKGKDYENEPSVYDL
HSSGGAPPVGGFIYRGCQSRRLYGSYVFGDKNGNLRILQKSPLSTSAGGEQWQEKALCLG
SAGSCGYLLVGHILGFGEDELGEVYMLASSKIMVQSNSGKLYKLVDPKRPPAPKECQRQV
EPPELLMTACSRHCKNGHCTPTGQCCCSLGWEGPFCRVAKCEPACRNGGVCIEPNMCMCK
SGYSGAQCEQSEQGMPNDQEKDGILDHIIDMTSYLLDLTSYIV
Download sequence
Identical sequences G3PYR6
ENSGACP00000022756 ENSGACP00000022756 69293.ENSGACP00000022756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]