SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PZ28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PZ28
Domain Number 1 Region: 220-328
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-24
Family SH2 domain 0.000005
Further Details:      
 
Domain Number 2 Region: 332-370
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PZ28
Sequence length 389
Comment (tr|G3PZ28|G3PZ28_GASAC) Suppressor of cytokine signaling 4 {ECO:0000313|Ensembl:ENSGACP00000022868} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=socs4 OC=Gasterosteus.
Sequence
MSERTPPGSDPPPKSGLRSWSADSYVWRGKKRSRSSRPGSTDGPEDPAARSTSCPRRRRD
RRCSCGALGDTSASGDRDSACRKALSRRSLRQKFQDAVGQCFPLRLPPGSSRPFSVLFWS
KRKVHVSELMQDKCPFSPRSELARCWHLVKSHAAHPGALKDTEAPLGPSASSSSASPQQT
PPAWEDICCSPGPRGSSLEDWDPSCPRGGPEGGHTDYILVPDLLQINNSCCYWGVLNRFE
AEELLEGKPEGTFLLRDSAQDEFLFSVSFRRYSRSLHARIEQNDQRFSFDVRDPCMYRDA
SVTGLLRHYSDPATCLFFEPLLSRPLPRSFPFTLQHLCRAVICSRTTYRGVDDLPLPPQL
RDYLRQYHVSSHRRTKRKDPPRASNIRET
Download sequence
Identical sequences G3PZ28
ENSGACP00000022868 ENSGACP00000022868 69293.ENSGACP00000022868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]