SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PZ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PZ74
Domain Number 1 Region: 105-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000111
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 252-310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000653
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 3 Region: 53-120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000486
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PZ74
Sequence length 454
Comment (tr|G3PZ74|G3PZ74_GASAC) Sushi-repeat containing protein, X-linked 2 {ECO:0000313|Ensembl:ENSGACP00000022914} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MCLLAFSTAVVLPEFFSAGSGTTEYDQYDDFVEEDYGPQLDYQHPNWCHSPGLTNGEVTC
RSPRGPAFRSTLGTRCEMSCDRGYRLLGRTSIQCLANRRWSGTAYCRKVRCHLLQLIPHG
RYTCTQGFVVDSRCDFTCDPGYRIAGQHSRTCQRSGSWSDAQPECEDTDPPKIKCPPSRL
KAAEPGKLTATVTWNPPTATDTADKSLNSVILVGQEPGTDFEEGASIIQYKVYDQARNRA
ACKFIVRVEVRRCPVLAAPQRGFLTCSSDGNNYGATCEHHCERGYERRGPSSRVCQFDRS
WEGSLVECVPMEIKSDVRTLSDLLNQFYEKRRLLIVSAPNISDPDYQLQNTMIQKSDCGL
DLRRVTVIELWGSPPGETGRIKEGLLSSEAIQGLRQVFKISRFHFSMLLLDELGLDRERF
ITPQASHELFYYIDSFLLDEEERGRLELQRDFCG
Download sequence
Identical sequences G3PZ74
ENSGACP00000022914 69293.ENSGACP00000022914 ENSGACP00000022914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]