SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q0M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q0M7
Domain Number 1 Region: 16-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000536
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3Q0M7
Sequence length 107
Comment (tr|G3Q0M7|G3Q0M7_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000023422} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MATPLPPPQHGGIDHNLPTCGDTQCSSHGTCVPSMDGGLVCDCNLGYQGETCDDTVNGSL
SLPLTLSVLAVIIGILIVAVILAKLRRKQKKRNRKHLEEKHGYDIVA
Download sequence
Identical sequences G3Q0M7
ENSGACP00000023422 69293.ENSGACP00000023422 ENSGACP00000023422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]