SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q1S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q1S3
Domain Number 1 Region: 105-223
Classification Level Classification E-value
Superfamily EF-hand 1.29e-30
Family Osteonectin 0.012
Further Details:      
 
Domain Number 2 Region: 192-286
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-25
Family Thyroglobulin type-1 domain 0.00068
Further Details:      
 
Domain Number 3 Region: 45-91
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000107
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3Q1S3
Sequence length 313
Comment (tr|G3Q1S3|G3Q1S3_GASAC) Sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 {ECO:0000313|Ensembl:ENSGACP00000023821} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
IKCSRHKVCVSEDYKTATCVSQRRVRNTITTVAENSSVYQSPGSKCKPCPVVHPSPVCGT
DGHSYSTKCKLDYQACITGKKIAVKCSGMCPCPSQPEQSSAEKKVCSESDLKEVVNRLRD
WFRVLYENGNHKRVKIQKPEKNKFEVGTSPICKDPVGWMFPRLDTNFDVQLDQSEIKSLY
LDRNEPCSDAFFKSCDTHMDKVITSSEWCTCFQRYTDSPCKEELSSINKKQAGKKVIGQY
LPSCDEEGYYRSHQCHSSSGQCWCVDRYGNEDASSRTHGPANCGVILESSGDLGSGDSLF
SDDDEDSFVLNDQ
Download sequence
Identical sequences G3Q1S3
ENSGACP00000023821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]