SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q344 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q344
Domain Number 1 Region: 159-360
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-51
Family Prokaryotic proteases 0.000000617
Further Details:      
 
Domain Number 2 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000832
Family Growth factor receptor domain 0.0041
Further Details:      
 
Domain Number 3 Region: 91-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000121
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3Q344
Sequence length 374
Comment (tr|G3Q344|G3Q344_GASAC) HtrA serine peptidase 3a {ECO:0000313|Ensembl:ENSGACP00000024294} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MQLLLLAAAVLFTHDLTGAVRSETCRSRCDVTSCPSPSCPDGYVPDRCNCCLACSPREGD
PCGRRNHLPCGDGLECKLLAAGRRRGTGGVCRCKMERAVCGSDGKTFGNVCKMRAASRKA
EQKGRAAVSQAHEGPCAPPGAAGRPLVHRSSPRYKFNFIADVVERIAPAVVHIELFLRHP
LFDRHMRLSSGSGFIVTHSGLIVTNAHVVTTAAAVTGRLQLRVQLRDGDAYEASVRDLDR
KADIATIKVDPQKKLPVLPLGRSADLRPGEFVVAIGSPFALQNTVTTGIVSTTQRDGKEL
GIKDSDMDYIQTDAIINKYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRIRRFLTE
SQIKHIKGQRSELE
Download sequence
Identical sequences G3Q344
ENSGACP00000024294 69293.ENSGACP00000024294 ENSGACP00000024294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]