SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q480 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G3Q480
Domain Number - Region: 760-824,908-929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number - Region: 489-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family Laminin-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3Q480
Sequence length 1114
Comment (tr|G3Q480|G3Q480_GASAC) Multiple EGF-like-domains 10 {ECO:0000313|Ensembl:ENSGACP00000024684} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MAMSLFHHRTVILAMAYCFLPCITSSLNLEDPNVCSHWESYSVTVQESYAHPFDQIYYAS
CTDILNWFKCTRQRVSYRTAYRRGEKTMYRRRSQCCPGFYENGEICAPHCATSCVHGRCM
APNTCQCDPGWGGSNCSSVCDSNHWGPHCSSRCQCQNGALCNPITGACICTPGYRGWRCE
AQCEVGTYGNGCQQKCQCQNGASCHHLTGECNCSSGYNGALLLDMISHGSQGLHTNYPLP
VHNWGVMELEGETGVPSSTLSTCPHASRGQYCLSTLQKHNGPTLSYLSLKCKKKSLIVNR
CQDHCPVGTYGAGCAKKCRCENYSKCYYTNGQCLCEPGYTGETCNARLCPEGHYGLRCDR
KCLCYAQNTRSCHPMSGECSCQPGWSGLYCNEMCTAGFYGESCQQVCQCQNGADCNSVTG
ACICTPGFTGPNCSVPCPTGTHGVDCFSHCNCKNKAQCSPVDGSCSCKQGWHGVDCSINC
PSGTWGVGCNLTCMCGKGGSCNALNGQCTCAPGWRGERCELRCQDGTYGLDCKARCHCSN
ADGCHHSTGHCRCLAGWTGIHCDSVCTQGRWGPNCSLPCNCKNGAFCSPDEGTCACAPGY
RGTTCQRICSPGYFGHRCSQTCPQCAHSNGPCHHVSGQCDCLPGFKGALCNEVCPSGQFG
KNCAWSCSCTNNGTCSPIDGSCQCYPGWIGSDCSQPCPPVQWGPNCIHTCNCHNGAYCSA
YDGECKCTPGWTGLYCTQRCPLGFYGKDCSLTCQCRNGANCDHISGQCTCRTGFMGRDCE
QRCPPGSYGYGCRQVCDCLNNSTCDHMTGTCYCNPGWKGARCDQAGVVVDSLNSLTSAAL
HVKTYRIGAIAGVIVLVLLLFFLFLLFIIYRKKQKGKEPSMAAVTYTSALTVTADYTIAD
AHPPESESHPSNYFSNPSYHTLTQCISSPHVNNGLNGKISGAKSNQLFVNLKHIDQRNRA
PLAEYNSTHPRDWKQENCVHELEHSWQGRSYVSKKDLKGTLYHASSCSLNSSENPYATIT
DPPQLTAKNLECGYVEMKSAVRQDSPYAEISNSSPTTNHNIYEAEPVSNIQLTEDSNGDM
QFGKDLYDLPKNSHIPCHYDLLPARESPLQENKE
Download sequence
Identical sequences G3Q480
ENSGACP00000024684 69293.ENSGACP00000024684 ENSGACP00000024684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]