SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q5D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q5D5
Domain Number 1 Region: 292-438
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-34
Family Regulator of G-protein signaling, RGS 0.0000102
Further Details:      
 
Domain Number 2 Region: 799-928
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-28
Family Pleckstrin-homology domain (PH domain) 0.0000346
Further Details:      
 
Domain Number 3 Region: 637-798
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-27
Family DBL homology domain (DH-domain) 0.0000177
Further Details:      
 
Domain Number 4 Region: 43-126
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-19
Family PDZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3Q5D5
Sequence length 1257
Comment (tr|G3Q5D5|G3Q5D5_GASAC) Rho guanine nucleotide exchange factor (GEF) 11 {ECO:0000313|Ensembl:ENSGACP00000025091} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
FNADPRSVVSHTRLSSLTIGDSERKSSAAQQREPMVDIHAESAATGLVQRCVVVQKDQLG
FGFTVCGERVKLVQNVRPGGAAVKAGVHEGDRIIKVNGSLVSSMSHQEVVKLIKSGPYAA
LTLQGPPPFAASLPLDPLPADLPPNKRTSLGGEAPPPPPPPLPSGLSSTPSQRITGPKPL
QDPEVQKHATQILRKMLEQEEAELQELREEQSRNPSPSLGERIESAQRRARQVRVKIQQD
LSRRPDVLSYISISIDPNPWYVHAAFTRARERERARDGGRSACSRCGSRWLQLFYLSVEA
YLGSSPKDARALAPQICSHFLDTDAPLKIRVREEYLSDIEGRLHAQEDIRGPLSELQQQV
LPDVQEQIQDYRNKQTMGLGSLFGEGDLLQLDGDPVKERQVVDRQVTALWEILSKHEEDR
SSPLASAVHLYLRHSGIKLRDSKVFPGLSSEKEKWLAFLKTKKPSGTKKEKDGEDKKRNP
ILKYIGKPRTTSQSRFYFTENNVTYQSAVKPRENTDPNMQHPPPSKNWCENSIQNSNFIV
ILISREKLLQFTTRLNCSGTTVCFRCIIYSCIYAHVCYTIEISHFSARPSLSLKLRSLEN
PTPPYTPRSRRRSVDSPLALLPDATAAALEEELSDGQNWQDTVPPQLLATLSPGEVDRQA
VIYELLTTEASHLRTLRVLDQVFFQKMRSVLNSEELACVFPNLPQVYDLHASLCEAMKKR
RETAIVQDIGDVMLARVSGSSSCNVKAVSVKSHSAASSDLPALQRAQACCRGILQAVNEV
VRETEHRQRLSQYQRRLDAAPHFKSLDLSTKRMIHEGPLTWKVSKDKQIEIQALLLSDCL
LLLQRGPDDRLQLRYPSRWLGGSGGGSVDSKNSFSPLVKLDALLVRPVATDNKALYVIST
TERQIYELVAGTSSERNTWKNLLERTISSPGGSSPLINHGPTPIWMYNSITEQSDSTDTH
SSGDDIALSATADTDQSEGFVGVERKAEGVAESALQDGEELRQLILRDLEEGDAWSHNSG
DTPTNETASERSSRRPESLETVLHFSADEWEAEPDAEAPPPDGEPPGSVQVVRKAVVAGP
SSSSSVPDDITADQSSKPRGNTFYLVMPTEPGESATDDLSGPRVPPPPPEDGTSPRTQPE
EETPAPEEEPGQSGAVRREGDEEAGPSQAGPQSHVIRNVDEIFHTIEGLMSKLRQLREIE
KSHQKLLKTLREPFADEEPEDQPRCPATVSRTPSLDRGSADGKAGGPAEPRVQSTGF
Download sequence
Identical sequences G3Q5D5
ENSGACP00000025091 ENSGACP00000025091 69293.ENSGACP00000025091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]