SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q684 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q684
Domain Number 1 Region: 96-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000945
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3Q684
Sequence length 327
Comment (tr|G3Q684|G3Q684_GASAC) Zgc:162331 {ECO:0000313|Ensembl:ENSGACP00000025392} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSLKVGPAAQSAGSLLLVLLWPLLCALVLAGSSTVSHVDPQSPAATSPPEDWTGTAIRLQ
PDLQTETLVLTEAQTEAQTEALPTQSTTSNYTGLCCIPVLPPRRGSFYVETGTGMSIGSV
LAFWCREGYQLVGSDKIYCNVRNGKPQWSNYLPVCEAIPRPEDRGLRVAVLASVVSGIVI
LAMSLSFLICCLQERSSRYRAKKEGRTRRRDKLSSRRSECWMEREEGEWQAFPPPKIFHL
SQRMNPRLAPDSPLYLTAGLGGYENRGYQRSQESLLKASLPGVYRSESQLYPHVVLQRVP
TPTAPSAPSAPSAPLYLHLPSSASSPA
Download sequence
Identical sequences G3Q684
69293.ENSGACP00000025392 ENSGACP00000025392 ENSGACP00000025392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]