SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3Q9D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q9D4
Domain Number 1 Region: 480-603
Classification Level Classification E-value
Superfamily TIMP-like 6.02e-24
Family Tissue inhibitor of metalloproteinases, TIMP 0.053
Further Details:      
 
Domain Number 2 Region: 244-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 3 Region: 317-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 379-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  G3Q9D4
Domain Number - Region: 80-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00117
Family N-terminal domain of xrcc1 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3Q9D4
Sequence length 603
Comment (tr|G3Q9D4|G3Q9D4_GASAC) Netrin 4 {ECO:0000313|Ensembl:ENSGACP00000026499} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=NTN4 OC=Gasterosteus.
Sequence
AGVGPRCESRACNPRMGNLALGRRVLTQTVCGNNATELYCSYSDPDANLACHAARCAKCN
AGLPLLSHLAGAMSDSSFRHPNTWWQSAEGVESETVQLDLEAEFYFTHLIVVFRSPRPAA
MTLERSQDFGRSWRMLQYYAGNCSAAFGMEEGGKAGRDGAACTAKYSGAYPCDRGEVIYR
ALPKWESLDPFGVEGQQQLRVTNVRIRLLKRQPCPCQAKDLAAAGEAPPTRHFAIYDLIV
KGSCFCNGHAEQCVTAPGYQPVRDRTNHVVHGKFTAKCVCRHNTAGDHCERCTPLYNDRP
WQPADGLTGAPHECSKCECSQHAESCRFDWTAWRESGQRSGGVCDCLHNTEGRRCDACKA
GFYRDRRRPRTAADSCRPCSCHPLGSTPFHPAGGSLCDPSNGNCICKPGVDGVRCERCMV
GYWGFHQYGCRPCDCAGDCDPFTGDCVYGSDLDNFDRNSSDSGWIFRADELFSARLPEKC
VCKEQALTNSKLFCTMSYAYVLKVKVLSAHDKGSHAEVEAEVQKVLSQSTKLKIRRGPVT
LYPESWTARGCTCPILNPGLEYLMAGHSDRKQGRLLVNMKSFVKPWTASLGRKVLALLKK
DCN
Download sequence
Identical sequences G3Q9D4
ENSGACP00000026499 69293.ENSGACP00000026499 ENSGACP00000026499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]