SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QAW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QAW6
Domain Number 1 Region: 54-206
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-24
Family C-type lectin domain 0.003
Further Details:      
 
Weak hits

Sequence:  G3QAW6
Domain Number - Region: 281-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QAW6
Sequence length 305
Comment (tr|G3QAW6|G3QAW6_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000027032} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MQKTIRSGSSGSSMPLLCALWLLMVCLAPGGQSQRLRETGAEQPAASGQLAERDALCHQK
GCYAVFFQKRNFREAGRSCRERGGTLATMHTDEAAAVVHKLLFAIEGTKSRLRLWIGLHR
SSRQCSSTRALRGFVWVTGDQDGQFTNWLHEENPGTCTVPRCVAMNVHTSESGRESKDNF
QWVDGSCALPLDGYVCQYIYKGMCPPLEDEGSGPALYTTPFHLLSSLLTHVPHNSMATLP
CPTDGSDPEAPAEQTVLCTERDDKTVGWSKDAPLCSLHRQDWCSRDHGCEQHCQNTDTDY
YCYCS
Download sequence
Identical sequences G3QAW6
ENSGACP00000027032 ENSGACP00000027032 69293.ENSGACP00000027032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]