SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QBH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QBH0
Domain Number 1 Region: 198-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-38
Family Dual specificity phosphatase-like 0.0000137
Further Details:      
 
Domain Number 2 Region: 374-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.26e-32
Family PLC-like (P variant) 0.004
Further Details:      
 
Domain Number 3 Region: 56-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000251
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QBH0
Sequence length 511
Comment (tr|G3QBH0|G3QBH0_GASAC) Transmembrane phosphatase with tensin homology {ECO:0000313|Ensembl:ENSGACP00000027236} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSSVHFSPGSDSGVNGNVAKMEDAKVNIDDGKDESVHPDTMYHNIRKKIAPFVMSFGFRI
FGVILILVDFVLVIVDLSLPAKSRGVGDALEVVSLLISFFFLADVLLRVYVEGLKVYFSS
QLNIVDACVVVITLVVTMIYTFSDLTGASLIPRVVTFLRFLRIIILVRVFRLAAQRKELE
KVTRRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQSFYRNPIKEVARFLDTKHE
GHYKVYNLCSEKGYDPQFFHYRVERVFIDDHNVPSLGDLLKYTANVREWMSADPQNIIAI
HCKGGKGRTGTMVCTWFIDSDQFESAKASLDYFGERRTDKSQSSKFQGVETPSQSRYVGY
YEIMKNKFNRQLPPPRSLVIKSIRIHSIAGVGKGDGSDLRVKIIVKKELVFQCVCGKQEN
CRVFPDVGGNAAVISLQNGPVVEGDVKVMFESSAGLPKGYEDVPFYFWFNTSFIEDNRLF
LPREELDNPHKPKMWDLYKEDFGVTMIFSEP
Download sequence
Identical sequences G3QBH0
ENSGACP00000027236 ENSGACP00000027236 69293.ENSGACP00000027236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]