SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QCU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QCU8
Domain Number 1 Region: 86-299
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.76e-82
Family Fibrinogen C-terminal domain-like 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QCU8
Sequence length 299
Comment (tr|G3QCU8|G3QCU8_GORGO) Ficolin 3 {ECO:0000313|Ensembl:ENSGGOP00000000046} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=FCN3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPG
PQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVF
CDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELR
VELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDS
SNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Download sequence
Identical sequences G3QCU8 O75636
9606.ENSP00000270879 ENSGGOP00000000046 ENSP00000270879 NP_003656.2.87134 NP_003656.2.92137 XP_004025312.1.27298 ENSP00000270879 ENSGGOP00000000046 ENSP00000270879 gi|27754776|ref|NP_003656.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]