SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QD59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QD59
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-16
Family Complement control module/SCR domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.78e-16
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 4 Region: 35-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000124
Family Complement control module/SCR domain 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QD59
Sequence length 399
Comment (tr|G3QD59|G3QD59_GORGO) CD46 molecule {ECO:0000313|Ensembl:ENSGGOP00000000168} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=CD46 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MEPPGRRECPFPSWRFPGLLLAALVLLLSSFSDACEEPPTFEAMELIGKPKPYYEIGERV
DYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAIIANGTYEFG
YQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEV
FEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQIS
GFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWDPPVPKCLKVLPPSSTKPPALSHS
VSTSSTTKSPASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIAVIVIAIVVGVAV
ICVVPYRYLQRRKKKGKADGGAEYATYQTKSTTPAEQRG
Download sequence
Identical sequences G3QD59
ENSGGOP00000018748 ENSGGOP00000000168 XP_004028366.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]