SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QDZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QDZ8
Domain Number 1 Region: 50-196
Classification Level Classification E-value
Superfamily L domain-like 3.26e-32
Family U2A'-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QDZ8
Sequence length 523
Comment (tr|G3QDZ8|G3QDZ8_GORGO) Dynein regulatory complex subunit 3 {ECO:0000313|Ensembl:ENSGGOP00000000481} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DRC3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MNRPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDN
LWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNR
ISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICA
YLPDLVYLDYRRIDDHTKELAEAKHQYSIDELKHRENLMQAQLEDEQARREELEKHKTAF
VEHLNGSFLFDSMYAEDSEGNKLSYLPGVGELLETYKDKFVIICVNIFEYGLKQQEKRKT
ELDTFSECVHEAIQENQEQGKRKIAKFEEKHLSSLSAIREESELPNIEKMILECSADISE
LFDALMTLEMQLVEQLEETINMFERNIVDMVGVFIENVQSLMAQCRDLESHHHEKLLEIS
ISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWC
TRLVDKIHKDEIMRNRKRVKEINQYIDHMQSELDNLECGDILD
Download sequence
Identical sequences G3QDZ8
XP_004042208.1.27298 ENSGGOP00000000481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]