SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QEH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QEH4
Domain Number 1 Region: 277-400,507-619
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.3e-44
Family Actin/HSP70 0.0011
Further Details:      
 
Domain Number 2 Region: 48-85,159-275
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00000000000000518
Family Actin/HSP70 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QEH4
Sequence length 624
Comment (tr|G3QEH4|G3QEH4_GORGO) Actin-related protein 8 {ECO:0000256|RuleBase:RU364121} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=ACTR8 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIVIHPGSTTLRI
GRATDTLPASIPHVIARRHKQQGQPLYKDSWLLREGLNKPESNEQRQNGLKMVDQAIWSK
KMSNGTRRIPVSPEQARSYNKQMRPAILDHCSGNKWTNTSHHPEYLVGEEALYVNPLDCY
NIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY
NKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSH
RNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLDQDISGL
QDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPH
DEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDG
LMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGG
GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQE
LWIYQREWQRFGVRMLRERAAFVW
Download sequence
Identical sequences A0A2J8T114 G3QEH4 Q9H981
ENSGGOP00000000668 9606.ENSP00000336842 gi|39812115|ref|NP_075050.3| NP_075050.3.87134 NP_075050.3.92137 XP_004034375.1.27298 XP_005265644.1.92137 XP_018879582.1.27298 ENSP00000231909 ENSP00000336842 ENSGGOP00000000668 ENSP00000336842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]