SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QEN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QEN7
Domain Number 1 Region: 53-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QEN7
Sequence length 209
Comment (tr|G3QEN7|G3QEN7_GORGO) MAX dimerization protein 4 {ECO:0000313|Ensembl:ENSGGOP00000000736} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MXD4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNE
LEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQ
QEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDA
DDHYSLQSGTGSDSGFGPHCRRLGRPALS
Download sequence
Identical sequences G3QEN7
XP_004038385.2.27298 ENSGGOP00000000736 ENSGGOP00000000736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]