SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QFC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QFC1
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000055
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QFC1
Sequence length 2237
Comment (tr|G3QFC1|G3QFC1_GORGO) Upstream transcription factor family member 3 {ECO:0000313|Ensembl:ENSGGOP00000000990} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=USF3 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MPEMTENETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGNNEQAEEIKKLRKQLEEIQKENGRYIELLKANDICLYDD
PTIHWKGNLKNSKVSVVIPSDQVQKNIIVYSNGNQPGGNSQGTAVQGITFNVSHNLQKQT
ANVVPVQRTCNLVTPVSISGVYPSENKPWHQTTVPALATNQPVPLCLPAAISAQSILELP
TSESESNVLGATSGSLIAVSIESEPHQHHSLHTCLNDQNSSENKNGQENPKVLKKMTPCV
TNIPHSSSATATKVHHGNKSCLSIQDFRGDFQNTFVVSVTTTVCSQPPRTAGDSSPVSIS
KSADLTSTATVVASSAPGVGKATIPISTLSGNPLDNGWTLSCSLPSSSVSTSDLKNINSL
TRISSAGNTQTTWTTLQLAGNTIQPLSQTPSSAVTPVLNESGTSPTTSNHSRHVATGINL
NNSFPADGQPVEQVVVTLPSCPSLPMQPLIAQPQVKSQPPKNILPLNSAMQVIQMAQPVG
SAVNAAPTNQNVIILQPPSTTPCPTVMRAEVPNQTVGQQIVIIQAANQNPLPLLPAPPPG
SVRLPINGANTVIGSNNSVQNVPTPQTFGGKHLVHILPRPSSLSASNSTQTFSVTMSNQQ
PQTISLNGQLFALQPVMSSSGTTNQTPMQIIQPTTSEDPNTNVALNTFGALASLNQSISQ
MAGQSCVQLSISQPANSQTVANSQTTTANCVSLTTTAAPPVTTDSSATLASTYNLVSTSS
MNTVACLPNMKSKRLNKKPGGRKHLAANKSACPLTSVRDVSKLDCPNTEGSAEPPCNDGL
LESFPAVLPSVSVSQANSVSVSASHSLGVLNSESLIPESVSKSKSAEKSSPPSQESVTSE
HFAMAAAKSKDSTPNLQQETSQDKPPSSSALSDAAKPCASANVLIPSPSDPHILVSQVPG
LSSTASTTSTDCVSEVEIIAEPCRVEQDSSDTMQTTGLLKGQGLTTLLSDLAKKKNPQKS
SLSDQMDHPDFSSENPKIVDSSVNLHPKQELLLMNNDDRDPPQHHSCLPDQEVINGSLIT
GRQADSPMSTSSGSSRSFSVASMLPETTREDVTSNATTNTCDSCTFVEQTDIVALAARAI
FDQENLEKGRVGLQADIREVASKPSEASLLEGDPPFKSQIPKESGTGQAEATPNEFNSQG
SIEATMERPLEKPSCSLGIKTSNASLQDSTSQPPSITSLSVNNLIHQSSISHPLASCAGL
SPASEQTTVPATVNLTVSSSSYGSQPPGPSLMTEYSQEQLSTMTSTIPNSQIQEPLLKPS
HESRKDSAKRAVQDDLLLSSAKRQKHCQPAPLRLESMSLMSRTPDTISDQTQMMVSQIPP
NSSNSVVPVSNPAHGDGLTRLFPPSNNFVTPALRQTEVQCGSQPSVAEQQQTQANQHLQA
LQQHVPAQGVSHLHSNHLYIKQQQQQQQQQAGQLRERHHLYQMQHHVPHAESSVHSQPHN
VHQQRTLQQEVQMQKKRNLVQGTQTSQLSLQPKHHGTDQSRSKSGQPHPHHQQMQQQMQQ
HFGSSQTEKSCENPSTSRNHHNHPQNHLNQDIMHQQQDVGSRQQGSGVSSEHVSGHNPMQ
RLLTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSNSEQRMGIS
IQGSRVSDQLEMRSYLDVPRNKSLAIHNMQGRVDHTVTSDIRLSDCQTFKPSGASQQPQS
NFEVQSSRNNEIGNPVSSLRSMQSQAFRISQNTGPPPIDRQKRLPYPPVQSIPTGNGIPS
RDSENTCHQSFMQSLLAPHLSDQVIGSQRSLSEHQRNTQCGPSSAIEYNCPPTHENVHIR
RESESQNRESCDMSLGVINTRNSTLNIPFSSSSSSGDIQGRNTSPNVSVQKSNPMRITDS
HATKGHMNPPVTTNMHGVARPALPHPSVSHGNGDQGPAVRQANSSVPQRSRHPLQDSSGS
KIRQPERNRSGNQRQSTVFDPSLPHLPLSTGGSMILGRQQPATEKRGSIVRFMPDSPQVP
NDNSGPDQHTLSQNFGFSFIPEGGMNPPINANASFIPQVTQPSATRTPALIPVDPQNTLP
SFYPPYSPAHPTLSNDISIPYFPNQMFSNPSTEKVNSGSLNNRFGSILSPPRPVGFAQPS
FPLLPDMPPMHMTNSHLSNFNMTSLFPEIATALPDGSAMSPLLTIANSSASDSSKQSSNR
PAHNISHILGHDCSSAV
Download sequence
Identical sequences G3QFC1
ENSGGOP00000000990 ENSGGOP00000000990 XP_004036122.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]