SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QFL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QFL0
Domain Number 1 Region: 740-986
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-62
Family Nuclear receptor ligand-binding domain 0.0000000633
Further Details:      
 
Domain Number 2 Region: 600-682
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-24
Family Nuclear receptor 0.0000243
Further Details:      
 
Weak hits

Sequence:  G3QFL0
Domain Number - Region: 698-705
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QFL0
Sequence length 988
Comment (tr|G3QFL0|G3QFL0_GORGO) Nuclear receptor subfamily 3 group C member 2 {ECO:0000313|Ensembl:ENSGGOP00000001086} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=NR3C2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
METKGYHSLPEGLDMERRWGQVSQAVEHSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNRPLRSFMSDSGSSVNGGLMRAI
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGNFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINSSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGKCSWQHNYLCAGRNDCIIDKIRRKNCP
ACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKE
PSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQ
MIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFN
EEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMR
TNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEF
PAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G3QFL0
ENSGGOP00000001086 ENSGGOP00000001086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]