SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QGB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QGB5
Domain Number 1 Region: 20-226
Classification Level Classification E-value
Superfamily L domain-like 4.86e-38
Family Ngr ectodomain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QGB5
Sequence length 345
Comment (tr|G3QGB5|G3QGB5_GORGO) Leucine rich repeats and transmembrane domains 1 {ECO:0000313|Ensembl:ENSGGOP00000001368} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=LRTM1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKGELLLFSSVIVLLQVVCSCPDKCYCQSSTNFVDCSQQGLAEIPSHLPPQTRTLHLQDN
QIHHLPAFAFRSVPWLMTLNLSNNSLSNLAPGAFHGLQHLQVLNLTQNSLLSLESRLFHS
LPQLRELDLSSNNISHLPTSLGETWENLTILAVQQNQLQQLDRALLESMPSVRLLFLKDN
LWKCNCHLLGLKLWLEKFVYKGGITDGIICESPDTWKGKDLLRIPHEVYQPCPLPAPDPV
SSQAQWPGSAHGVVLRPPENHNAGERDLLECELKPKPRPANLRHAIATIIITGVVCGIVC
LMMLAAAIYGCTYAAITAQYHGGPLAQTNDPGKVEEKERFDSSPA
Download sequence
Identical sequences G3QGB5
ENSGGOP00000001368 XP_004034381.1.27298 ENSGGOP00000001368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]