SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QH64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QH64
Domain Number 1 Region: 51-108
Classification Level Classification E-value
Superfamily GLA-domain 6.39e-20
Family GLA-domain 0.00068
Further Details:      
 
Weak hits

Sequence:  G3QH64
Domain Number - Region: 164-173
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0458
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QH64
Sequence length 202
Comment (tr|G3QH64|G3QH64_GORGO) Proline rich and Gla domain 2 {ECO:0000313|Ensembl:ENSGGOP00000001686} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=PRRG2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MRGHPSLLLLYMALTTCLDTSPSGETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTP
GNLERECLEERCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVAGLAVGLTCGILL
IVLAGLGAFWYLHWRRRRGQQPCPQEAGLISLLSPLSPLGPPTPLPPPPPPPPGLPTYEQ
ALAASGVHDAPPPPYTSLRRPH
Download sequence
Identical sequences G3QH64
XP_004061218.1.27298 ENSGGOP00000001686 ENSGGOP00000001686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]