SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QHJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QHJ0
Domain Number 1 Region: 13-43
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000016
Family HLH, helix-loop-helix DNA-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QHJ0
Sequence length 77
Comment (tr|G3QHJ0|G3QHJ0_GORGO) Hes family bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSGGOP00000001819} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=HES2 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRECLATATARATAPV
WRAWPACCPPAVSWSPP
Download sequence
Identical sequences A0A2I3RQD2 G3QHJ0 K7EJN2
ENSP00000465248 ENSP00000465248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]