SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QHT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QHT1
Domain Number 1 Region: 217-557,638-662
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3e-93
Family Myotubularin-like phosphatases 0.00000646
Further Details:      
 
Domain Number 2 Region: 35-180
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-27
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QHT1
Sequence length 773
Comment (tr|G3QHT1|G3QHT1_GORGO) Myotubularin related protein 10 {ECO:0000313|Ensembl:ENSGGOP00000001917} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MTMR10 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MFSLKPPKPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKINGIPSGDGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGWRVCSI
NEGYMISTCLPEYIVVPSSLADQDLKIFSHSFIGRRMPLWCWSHSNGSALVRMALIKDVL
QQRKIDQRICNAITKSHPQRSDVYKSDLDKTLPNIQEVQAAFVKLKQLCVNEPFEETEEK
WLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVVLQEEEGRDLSCCVASLVQVMLDPY
FRTITGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAAFEFS
ETYLAVLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQF
TAKDRTLFHNPFYIGKSTPCIQNGSVKSFKRTKKSYSSTLRGMPSALKNGIISDQELLPR
RNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGTHIKLWKLCYFRW
VPEAQISLGGSITAFHKLSLLADEVDVLSRMLRQQRSGPLEACYGELGQSRMYFNASGPH
HTDTSGTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences G3QHT1
XP_004055936.1.27298 ENSGGOP00000001917 ENSGGOP00000001917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]