SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QI21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QI21
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.03e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000883
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3QI21
Sequence length 353
Comment (tr|G3QI21|G3QI21_GORGO) Mitochondrial ribosomal protein L39 {ECO:0000313|Ensembl:ENSGGOP00000002017} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=MRPL39 OC=Catarrhini; Hominidae; Gorilla.
Sequence
VEALAMGSRALRLWRVAPGGGISWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPATVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
ESCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKIDFI
EEKASQNSERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPVHLRAHFTIWDKLLERSRKMTPFPILFLFTTQSFFTTSPESYLLHGTVSE
Download sequence
Identical sequences G3QI21
ENSGGOP00000002017 ENSGGOP00000026535 ENSGGOP00000018345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]