SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QJ86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJ86
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.91e-25
Family Ubiquitin-related 0.00000663
Further Details:      
 
Domain Number 2 Region: 272-339
Classification Level Classification E-value
Superfamily XPC-binding domain 3.4e-24
Family XPC-binding domain 0.0000183
Further Details:      
 
Domain Number 3 Region: 174-230
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000559
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 356-407
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000172
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QJ86
Sequence length 409
Comment (tr|G3QJ86|G3QJ86_GORGO) RAD23 homolog B, nucleotide excision repair protein {ECO:0000313|Ensembl:ENSGGOP00000002471} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=RAD23B OC=Catarrhini; Hominidae; Gorilla.
Sequence
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences G3QJ86 P54727
gi|4506387|ref|NP_002865.1| ENSP00000396975 ENSP00000350708 9606.ENSP00000350708 ENSGGOP00000002471 ENSP00000350708 NP_002865.1.87134 NP_002865.1.92137 XP_003810947.1.60992 XP_018889482.1.27298 ENSGGOP00000002471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]