SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QJH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJH4
Domain Number 1 Region: 82-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000942
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3QJH4
Sequence length 214
Comment (tr|G3QJH4|G3QJH4_GORGO) Transcription factor 23 {ECO:0000313|Ensembl:ENSGGOP00000002569} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=TCF23 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRTTP
GPRGTRAGGLALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTAST
PSQRTRDAEVGSQVPGEADALLSTTPLSPALGDK
Download sequence
Identical sequences G3QJH4
XP_004029033.1.27298 ENSGGOP00000002569 ENSGGOP00000002569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]