SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3QJK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3QJK4
Domain Number 1 Region: 165-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.72e-45
Family Dual specificity phosphatase-like 0.0000196
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.91e-24
Family Cell cycle control phosphatase, catalytic domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3QJK4
Sequence length 384
Comment (tr|G3QJK4|G3QJK4_GORGO) Dual specificity protein phosphatase {ECO:0000256|PIRNR:PIRNR000939} KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=DUSP5 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKVTSLDGRQLRKMLRKETAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSEYPECCVDVKPISQEKIESERNLISQCGKPVVNVSYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTTHLHYKWIPVEDSHTADISS
HFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTNQFRLKEAFDYIKQRRSMV
SPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASV
LAPVPTHSTVSELSRSPVATATSC
Download sequence
Identical sequences G3QJK4
ENSGGOP00000002600 ENSGGOP00000002600 XP_004050139.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]